A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10126 |
Swiss-prot Accession number | Q6IY74 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 141 Amino acids |
Molecular weight | 14752 |
References | 1 Suzuki O.; "Rabbit luteinizing hormone gene."; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases.
2 Glenn S.D., Nahm H.S., Ward D.N.; "The amino acid sequence of the rabbit lutropin beta subunit."; J. Protein Chem. 3:259-273(1984). |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | QAPRGPLRPLCRPVNATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASIRLPGCPPGVDPEVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDLPHLPGLLFL |
Position of mature hormone in Pre-Hormone protein | 123 Residues from position (19-141) |
Receptor | N/A |
Gene ID | 100009427 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10208 |
Swiss-prot Accession number | Q6IY73 (Sequence in FASTA format) |
Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
Protein Length | 129 Amino acids |
Molecular weight | 14588 |
References | 1 Suzuki O.; Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
2 Suzuki O.; Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Cys_knot |
Hormone Name | Follicle-stimulating hormone beta subunit |
Mature Hormone Sequence | SSCELTNITIAVEKEECRFCISINTTWCSGYCYTRDLVYKDPARPNIQKICTFKELVYETVRVPGCAHHADSLYTYPVATECHCGNCDSDSTDCTVRGLGPSYCSFGEMKE |
Position of mature hormone in Pre-Hormone protein | 111 Residues from position (19-129) |
Receptor | N/A |
Gene ID | 100008946 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10324 |
Swiss-prot Accession number | Q28632 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 227 Amino acids |
Molecular weight | 25990 |
References | 1 PubMed abstract 8672230 2 PubMed abstract 9094747 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (29-227) |
Receptor | P14787
Detail in HMRbase |
Gene ID | 100009394 |
PDB ID | 1AN3 |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10489 |
Swiss-prot Accession number | P69043 (Sequence in FASTA format) |
Description | Oxytocin (Ocytocin). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the vasopressin/oxytocin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland |
Protein Length | 9 Amino acids |
Molecular weight | 1010 |
References | 1 PubMed abstract 5150741 |
Domain Name | N/A |
Hormone Name | Oxytocin |
Mature Hormone Sequence | CYIQNCPLG |
Position of mature hormone in Pre-Hormone protein | 9 Residues from position (1-9) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10689 |
Swiss-prot Accession number | P41336 (Sequence in FASTA format) |
Description | Pancreatic hormone (Pancreatic polypeptide) (PP). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 36 Amino acids |
Molecular weight | 4197 |
References | 1 PubMed abstract 8299350 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10887 |
Swiss-prot Accession number | P01311 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 110 Amino acids |
Molecular weight | 11838 |
References | 1 PubMed abstract 8132571 2 PubMed abstract 5949593 3 Giddings S.J., Carnaghi L.R., Devaskar S.U.; Submitted (APR-1991) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKS |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
Receptor | N/A |
Gene ID | 100009181 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10888 |
Swiss-prot Accession number | P01311 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 110 Amino acids |
Molecular weight | 11838 |
References | 1 PubMed abstract 8132571 2 PubMed abstract 5949593 3 Giddings S.J., Carnaghi L.R., Devaskar S.U.; Submitted (APR-1991) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCTSICSLYQLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (90-110) |
Receptor | N/A |
Gene ID | 100009181 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10949 |
Swiss-prot Accession number | P06297 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin (Pro-opiomelanocortin) (POMC) [Contains:Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP)](Fragment). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | N/A |
Function | ACTH stimulates the adrenal glands to release cortisol |
Protein Length | 39 Amino acids |
Molecular weight | 4478 |
References | 1 PubMed abstract 3013598 2 PubMed abstract 3013598 |
Domain Name | ACTH_domain |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAENESAEAFPVEV |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (1-39) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10950 |
Swiss-prot Accession number | P06297 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin (Pro-opiomelanocortin) (POMC) [Contains:Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP)](Fragment). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | N/A |
Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
Protein Length | 39 Amino acids |
Molecular weight | 4478 |
References | 1 PubMed abstract 3013598 2 PubMed abstract 3013598 |
Domain Name | ACTH_domain |
Hormone Name | Melanotropin alpha (Alpha-MSH) |
Mature Hormone Sequence | SYSMEHFRWGKPV |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (1-13) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10994 |
Swiss-prot Accession number | P07474 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13413 |
References | 1 PubMed abstract 12112597 2 Glenn S.D., Nahm H.S., Ward D.N.; "The amino acid sequence of the rabbit glycoprotein hormone alphasubunit."; J. Protein Chem. 3:143-156(1984). 3 PubMed abstract 12112597 4 Glenn S.D., Nahm H.S., Ward D.N.; "The amino acid sequence of the rabbit glycoprotein hormone alphasubunit."; J. Protein Chem. 3:143-156(1984). |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | FPDGEFAMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
Receptor | N/A |
Gene ID | 100009481 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11063 |
Swiss-prot Accession number | P34032 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | Originally found in thymus but it is widely distributed in many tissues |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 5037 |
References | 1 PubMed abstract 6838210 |
Domain Name | Thymosin |
Hormone Name | Thymosin beta-4 |
Mature Hormone Sequence | ADKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11118 |
Swiss-prot Accession number | P68274 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis |
Protein Length | 29 Amino acids |
Molecular weight | 3483 |
References | 1 PubMed abstract 5011077 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11435 |
Swiss-prot Accession number | P32647 (Sequence in FASTA format) |
Description | Secretin. |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach |
Protein Length | 27 Amino acids |
Molecular weight | 3106 |
References | 1 PubMed abstract 2342988 |
Domain Name | Hormone_2 |
Hormone Name | Secretin |
Mature Hormone Sequence | HSDGTLTSELSRLRDRARLQRLLQGLL |
Position of mature hormone in Pre-Hormone protein | 27 Residues from position (1-27) |
Receptor | O46502
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11461 |
Swiss-prot Accession number | P46407 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 216 Amino acids |
Molecular weight | 24433 |
References | 1 PubMed abstract 7590276 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (27-216) |
Receptor | P19941
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11549 |
Swiss-prot Accession number | B0KZL0 (Sequence in FASTA format) |
Description | Leptin |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 167 Amino acids |
Molecular weight | 18233 |
References | 1 PubMed abstract 18213380 |
Domain Name | Leptin |
Hormone Name | Leptin |
Mature Hormone Sequence | |
Position of mature hormone in Pre-Hormone protein | |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |